Chromohalobacter japonicus

Author: oclr

August undefined, 2024

WebFeb 12, 2024 · A search in the GenBank database identified benA genes in only two strains of the genus Chromohalobacter: a gene encoding the α‑subunit of benzoate 1,2-DO (EU155151) in Chromohalobacter sp. HS-2 and genes of the α-subunit of benzoate 1,2-DO and benzoate-toluate 1,2-DO (QGTY01000032 and QGTY01000001) in C. salexigens … WebA moderately halophilic psychrotolerant bacterium, strain N1, closely related to the species Chromohalobacter japonicus was isolated from the salt crust of a rock salt waste pile …

Chromohalobacter - Wikipedia

WebMar 8, 2015 · The production of halophilic enzymes, such as laccase, LiP, and MnP has been reported for some halophiles Chromohalobacter sp., Aquisalibacillus elongates, … WebOverall, the phenotypic, genotypic and phylogenetic results demonstrated that strain 43(T) represents a novel species within the genus Chromohalobacter. A Gram-negative, non-spore-forming, rod-shaped, motile bacterium, designated strain 43(T), was isolated from a Japanese salty food and then subjected to a polyphasic taxonomic study. Strain 43(T) is … how many episodes did portlandia have

Chromohalobacter - Ventosa - Major Reference Works

WebNov 1, 2007 · Chromohalobacter japonicus sp nov., a moderately halophilic bacterium isolated from a Japanese salty food Authors: Cristina Sánchez-Porro Universidad de Sevilla Hiroko Tokunaga Masao … WebNov 2, 2024 · The fruit extracts of C. japonica (CJ) have been reported to have anticancer activity 22, cardiovascular protection effect 23, and gastroprotective effect via … WebThis is the type strain for Chromohalobacter japonicus Sánchez-Porro et al. 2007. 16S gene. AB105159. Citation. When referring to this Abstract, please use its Digital Object Identifier and cite NamesforLife. Exemplar Abstract for 43 (=CCM 7416 =CECT 7219). NamesforLife, LLC. how many episodes did shippuden have

(PDF) Chromohalobacter japonicus sp nov., a moderately …

WebChromohalobacter Click on organism name to get more information. Chromohalobacter beijerinckii Chromohalobacter canadensis Chromohalobacter israelensis Chromohalobacter japonicus Chromohalobacter marismortui Chromohalobacter nigrandesensis Chromohalobacter salexigens Chromohalobacter salexigens DSM 3043 WebGenus Chromohalobacter. Etymology: Chro.mo.ha.lo.bac.ter. Gr. neut. n. chrôma, color; Gr. masc. n. hals (gen. halos), salt; N.L. masc. n. bacter, rod; N.L. masc. n. … how many episodes did glee haveWebName: Chromohalobacter japonicus Sánchez-Porro et al. 2007 Category: Species Proposed as: sp. nov. Etymology: ja.po’ni.cus. N.L. masc. adj. japonicus, Japanese Gender: masculine Type strain: 43; CCM 7416; CECT 7219 See detailed strain information at Conduct genome-based taxonomy at 16S rRNA gene: AB105159 Analyse FASTA how many episodes did naruto 2002 last

"WebOct 1, 2007 · Chromohalobacter japonicus sp. nov., a moderately halophilic bacterium isolated from a Japanese salty food. Cristina Sánchez-Porro Department of Microbiology … " - Chromohalobacter japonicus

Chromohalobacter japonicus

Chromohalobacter - an overview ScienceDirect Topics

WebChromohalobacter beijerinckii is a motile, rod-like, salt-loving, Gram-negative soil bacterium, 0.4–0.6 μm by 1.8–2.5 μm. The bacterium was isolated in 1935 by T. Hof … WebDec 1, 2024 · It revealed that mostly Tetragenococcus (80.9%) and Halomonadaceae (15.3%) were present in brine A ( Fig. 1 A). In brine C, Tetragenococcus (60.1%) and Halomonadaceae (19.2%) were present too, next to Halanaerobium (17.7%), Chromohalobacter (1.2%), which belongs to the Halomonadaceae family, and …

Did you know?

WebDisclaimer: The NCBI taxonomy database is not an authoritative source for nomenclature or classification - please consult the relevant scientific literature for the most reliable WebMay 24, 2024 · Kosakonia cowanii, formerly known as Enterobacter cowanii, is a Gram-negative bacillus belonging to the order Enterobacterales. The species is usually recognized as a plant pathogen and has only anecdotally been encountered as a human pathogen.

WebChromohalobacter japonicus 43 is an aerobe, mesophilic, Gram-negative bacterium that was isolated from food product. Gram-negative. motile. rod-shaped. aerobe. mesophilic. …

WebFeb 1, 2010 · A total of 14 Halomonas strains were isolated from the blood of two patients and from dialysis machines of a renal care centre. The strains were Gram-negative, halophilic, motile and non-spore-forming rods. They produced cream-coloured colonies and contained Q-9 as the predominant ubiquinone and C18 : 1 ω7c and C16 : 0 as the major … Web48.2.1 Alpha-Amylases. Alpha-amylases belong to the family of endo -amylases and act on starch to yield glucose and maltose. The first starch-degrading enzyme was discovered …

WebChromohalobacter japonicus sp. nov., a moderately halophilic bacterium isolated from a Japanese salty food. A Gram-negative, non-spore-forming, rod-shaped, motile …

WebJul 1, 2024 · However, average nucleotide highest identity values of TMW 2.2308 T to C. beijerinckii LMG 2148 T of 93.12% and 92.88% to C. japonicus CECT 7219 T demonstrate that it represents a novel species within the genus Chromohalobacter with additional strains TMW 2.2299 (96.91%) and TMW 2.2304 (96.98%). how many episodes did the flintstones haveWebThe proteobacterium Chromohalobacter salexigens can endure some of the widest reported salinity ranges ... 2002) or by L-lysine α-oxidase from Scomber japonicus and … how many episodes did friends have in totalWeb>CAPGI00980 C2M4T5 OMAGroup:1132072 [Capnocytophaga gingivalis] MKKIGKNLEIKNIIIHQLLKEAGNGIVDAKSADHVLNISDREKLFLGNLDEAYYKKSEIIHGIFSGNFPKFKDLLLEYTE ... high value high risk frameworkWebcurrent name Chromohalobacter japonicus Sanchez-Porro et al. 2007 type strain of Chromohalobacter japonicus: CCM :7416, CECT :7219, personal::43 includes: … how many episodes does 6teen haveWebChromohalobacter japonicus 43 is an aerobe, mesophilic, Gram-negative bacterium that was isolated from food product. Gram-negative. motile. rod-shaped. aerobe. mesophilic. 16S sequence. Bacteria. high value german stampsWebDec 7, 2024 · Bacteriophages function as a regulator of host communities and metabolism. Many phages have been isolated and sequenced in environments such as the ocean, but very little is known about hypersaline environments. Phages infecting members of the genus Chromohalobacter remain poorly understood, and no Chromohalobacter phage … high value high riskWebChromohalobacter moromii sp. nov., a moderately halophilic bacterium isolated from lupine-based moromi fermentation Syst Appl Microbiol. 2024 Apr 26;45 (4):126324. doi: 10.1016/j.syapm.2024.126324. Online ahead of print. Authors Rebekka H Lülf 1 , Maik Hilgarth 2 , Matthias A Ehrmann 3 Affiliations high value goods examples